Anti-Kv11.1 antibody GTX54785 from GeneTex

Description

GeneTex's Anti-Kv11.1 antibody is a Rabbit Polyclonal antibody. The Anti-Kv11.1 antibody was generated using potassium voltage-gated channel subfamily H member 2, ERG-1, ERG1, H-ERG, HERG, HERG1, Kv11.1, LQT2, SQT1 as the antigen. The Anti-Kv11.1 antibody from GeneTex is a Rabbit Polyclonal antibody to Kv11.1. The Anti-Kv11.1 antibody Recognizes Human, Mouse, Rat. The Anti-Kv11.1 antibody has been validated for the following Applications: WB, ICC/IF, IP, IHC

Product Specs
ItemAnti-Kv11.1 antibody
CompanyGeneTex
Price Pricing Info Supplier Page
Catalog NumberGTX54785
Quantity50 µl
ApplicationsWB, ICC/IF, IP, IHC
Concentration0.6mg/ml
Conjugate/TagUnconjugated
FormatPBS, 1% BSA, 0.025% Sodium azide
PurityDepleted of anti-GST antibodies by affinity chromatography on immobilized GST and purified by antigen-affinity chromatography
ReactivityHuman, Mouse, Rat
TargetKv11.1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenGST fusion protein with sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 (Intracellular, C-terminus) of human Kv11.1 (HERG) (Accession : Q12809), (MW: 35 kDa.)
NCBI Full Gene Namepotassium voltage-gated channel subfamily H member 2
NCBI Gene AliasesKv11.1, ERG-1, ERG1, HERG1, HERG, H-ERG, SQT1, potassium voltage-gated channel subfamily H member 2, ERG-1, ERG1, H-ERG, HERG, HERG1, Kv11.1, LQT2, SQT1, LQT2
ClonalityPolyclonal
Research AreaNeuroscience
Gene NameKCNH2
Molecular Weight127